Cat: PA1000-4058

Recombinant Human IZUMO4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IZUMO4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IZUMO4;C19orf36;Izumo sperm-egg fusion Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q1ZYL8

  • Expression Region

    16-214aa

  • AA Sequence

    HGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDTMKELH LAIPAKITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQVH LIQNAIIESRIDCQHRCGIFQYETISCNNCTDSHVACFGYNCESSAQWKS AVQGLLNYINNWHKQDTSMSLVSPALRCLEPPHLANLTLEDAAECLKQHV DDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IZUMO4 is a member of the IZUMO family of proteins, which play critical roles in mammalian reproduction, particularly in the fertilization process. The IZUMO proteins are primarily expressed in sperm and are involved in the interaction with oocytes, facilitating the binding and fusion necessary for sperm-egg fusion. The study of IZUMO4, in particular, has garnered attention due to its potential implications in reproductive biology and fertility treatments. Recent research has suggested that IZUMO4 may have unique functions that distinguish it from other members of the IZUMO family, such as IZUMO1, which is essential for sperm-egg binding. Understanding the structure and function of the IZUMO4 protein could provide valuable insights into the molecular mechanisms underlying fertilization. Additionally, characterizing its interactions with egg-specific receptors and other seminal factors may pave the way for innovative approaches to address infertility issues. Recombinant IZUMO4 proteins are being developed for further studies to elucidate their functional roles and interactions within the reproductive system. This research not only aims to enhance our understanding of fertilization but also opens new avenues for therapeutic interventions in reproductive health, highlighting the importance of continued exploration in this specialized field of study.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US