Cat: PA1000-4055

Recombinant Human CSNK1G2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CSNK1G2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CSNK1G2;CK1G2;Casein kinase I isoform gamma-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78368

  • Expression Region

    18-415aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSKAGGGRSSHGIRSSGTSSGVLMVGPNFR VGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLS ATEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAI QLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYID PETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLR GSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRL DFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPS QPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADET KCCCFFKRRKRKSLQRHK

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CSNK1G2, or Casein Kinase 1 Gamma 2, is a member of the Casein kinase family, which plays a crucial role in various cellular processes such as signal transduction, cell cycle regulation, and the circadian rhythm. This serine/threonine kinase is involved in the phosphorylation of proteins that are integral to these pathways, thus influencing cellular activities and functions. Mutations and dysregulation of CSNK1G2 have been associated with several diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. Research into the recombinant expression of CSNK1G2 is pivotal for understanding its biochemical properties, functional roles, and interactions with other cellular proteins. Moreover, producing this recombinant protein allows for in vitro analyses, enabling researchers to dissect its enzymatic activity and regulatory mechanisms. By elucidating the structure-function relationship of CSNK1G2, scientists aim to uncover the molecular basis of its involvement in pathologies, paving the way for the development of novel pharmacological strategies. Thus, the investigation of CSNK1G2 recombinant protein is essential not only for basic biological research but also for potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US