Analytical Data
-
Gene name
ENA78
- Application
-
Alternative Names
ENA78；ENA78；C-X-C motif chemokine 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42830
-
Expression Region
41-114aa
-
AA Sequence
AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEI CLDPEAPFLKKVIQKILDGGNKEN
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ENA78, also known as CXCL5, is a chemokine involved in inflammatory responses and immune regulation. It plays a crucial role in recruiting neutrophils to sites of injury or infection, making it vital for innate immunity. Research into ENA78 has gained momentum due to its implications in various pathological conditions, including cancer, respiratory diseases, and autoimmune disorders. Elevated levels of ENA78 have been associated with tumor progression and metastasis, as well as with chronic inflammatory diseases such as asthma and rheumatoid arthritis. The recombinant expression of ENA78 is essential for studying its biological functions and molecular mechanisms in detail. By producing ENA78 as a recombinant protein, researchers can investigate its structure, receptor interactions, and signaling pathways more effectively. Additionally, recombinant ENA78 can be used in therapeutic applications, providing potential avenues for developing novel treatments targeting ENA78-related pathways. Understanding ENA78’s role in inflammation and disease progression presents significant opportunities for therapeutic interventions aimed at modulating immune responses. Overall, the study of recombinant ENA78 is crucial for elucidating its functions in health and disease, highlighting its potential as a biomarker and therapeutic target.
