Cat: PA2000-1813

Recombinant Human EDNRA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EDNRA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EDNRA;ETA;ETRA;Endothelin-1 receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25101-1

  • Expression Region

    21-427aa

  • AA Sequence

    DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

  • Molecular Weight

    47.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of Endothelial Differentiation-Related Factor 1 (EDNRA) recombinant protein has gained significant attention due to its crucial role in angiogenesis, vascular development, and various cardiovascular diseases. EDNRA is a key receptor for endothelin-1, a potent vasoconstrictor peptide that influences blood flow and pressure. Abnormalities in endothelin signaling have been implicated in several pathological conditions, including hypertension, heart failure, and pulmonary arterial hypertension. Research into EDNRA recombinant protein is driven by the need to better understand these molecular mechanisms and to identify potential therapeutic targets. By producing EDNRA in a recombinant form, scientists can explore its structure, function, and interactions with other cellular components more effectively. This research also opens avenues for the development of novel therapeutic agents that can modulate endothelin signaling, potentially providing relief from cardiovascular diseases and improving patient outcomes. Furthermore, studying the effects of EDNRA on endothelial cell function can shed light on the processes of blood vessel formation and repair, contributing to advancements in regenerative medicine and tissue engineering. As the understanding of EDNRA's roles in various biological contexts deepens, its recombinant protein may serve as a valuable tool in both basic research and clinical applications, enhancing our ability to address complex cardiovascular disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US