Analytical Data
-
Gene name
EDNRA
- Application
-
Alternative Names
EDNRA;ETA;ETRA;Endothelin-1 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25101-1
-
Expression Region
21-427aa
-
AA Sequence
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
-
Molecular Weight
47.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of Endothelial Differentiation-Related Factor 1 (EDNRA) recombinant protein has gained significant attention due to its crucial role in angiogenesis, vascular development, and various cardiovascular diseases. EDNRA is a key receptor for endothelin-1, a potent vasoconstrictor peptide that influences blood flow and pressure. Abnormalities in endothelin signaling have been implicated in several pathological conditions, including hypertension, heart failure, and pulmonary arterial hypertension. Research into EDNRA recombinant protein is driven by the need to better understand these molecular mechanisms and to identify potential therapeutic targets. By producing EDNRA in a recombinant form, scientists can explore its structure, function, and interactions with other cellular components more effectively. This research also opens avenues for the development of novel therapeutic agents that can modulate endothelin signaling, potentially providing relief from cardiovascular diseases and improving patient outcomes. Furthermore, studying the effects of EDNRA on endothelial cell function can shed light on the processes of blood vessel formation and repair, contributing to advancements in regenerative medicine and tissue engineering. As the understanding of EDNRA's roles in various biological contexts deepens, its recombinant protein may serve as a valuable tool in both basic research and clinical applications, enhancing our ability to address complex cardiovascular disorders.











