Analytical Data
-
Gene name
C10orf59
- Application
-
Alternative Names
6530404N21Rik; AI452315; AW060440; C10orf59; Chromosome 10 open reading frame 59; FLJ11218; HGNC:25641
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VYX0
-
Expression Region
1-342aa
-
AA Sequence
MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
-
Molecular Weight
64.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C10orf59, a gene located on chromosome 10, encodes a protein whose precise biological function remains largely unexplored. Emerging evidence suggests that it may play a role in various cellular processes, including cell proliferation and differentiation, thus implicating it in important developmental pathways and potential disease mechanisms. Recent studies indicate that alterations in the expression or function of C10orf59 might be associated with certain cancers and neurodegenerative disorders, sparking interest in its therapeutic potential. Moreover, the recombinant expression of C10orf59 provides a valuable tool for understanding its structure-function relationship and biological relevance. By producing and purifying the recombinant protein, researchers can conduct functional assays to elucidate its role in cellular contexts and identify potential interacting partners. This foundational research could pave the way for novel interventions in diseases linked to dysregulation of C10orf59, highlighting the necessity of further investigation into its molecular characteristics and implications in health and disease.
