Cat: PA1000-4038

Recombinant Human IL20RB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL20RB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL20RB;DIRS1;Interleukin-20 receptor subunit beta

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6UXL0

  • Expression Region

    30-230aa

  • AA Sequence

    DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYT SHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKH PFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEH VKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE AVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL20RB (Interleukin 20 receptor beta) is a crucial component of the cytokine signaling pathway that regulates various immune responses and inflammatory processes. Research has increasingly focused on IL20RB due to its role in mediating the effects of interleukin-20 (IL-20) and interleukin-24 (IL-24), both of which are implicated in skin conditions like psoriasis and other autoimmune disorders. IL20RB forms a receptor complex with IL20RA, and their interaction is essential for transducing signals that contribute to the differentiation and proliferation of immune cells. Understanding the structure and function of IL20RB, particularly through recombinant protein studies, can provide insights into its role in disease mechanisms. Furthermore, as a target for therapeutic intervention, IL20RB presents opportunities for the development of novel biologics aimed at modulating immune responses. Recombinant IL20RB can be utilized in various assays to explore its interactions with other cytokines and receptors, as well as to identify potential inhibitors or agonists. This research is vital not only for elucidating the basic biology of cytokine signaling but also for the potential advancement of treatments for inflammatory diseases that involve the IL-20 signaling pathway.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US