Cat: PA1000-4035

Recombinant Human PTH1R Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PTH1R

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PTH1R;PTHR;Parathyroid hormone/parathyroid hormone-related peptide receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q03431

  • Expression Region

    27-188aa

  • AA Sequence

    DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSG KPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEV VAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTN ETREREVFDRLG

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PTH1R (Parathyroid Hormone 1 Receptor) is a critical G protein-coupled receptor that plays a significant role in regulating calcium and phosphate metabolism through its interaction with parathyroid hormone (PTH) and parathyroid hormone-related peptide (PTHrP). Dysregulation of PTH1R signaling is implicated in various bone and mineral disorders, including osteoporosis, hypoparathyroidism, and certain types of cancers. Due to the receptor's vital functions, understanding its structure and signaling mechanisms is essential for developing targeted therapies. Recombinant PTH1R proteins, generated through advanced biotechnological methods, facilitate the exploration of the receptor's properties, enabling researchers to investigate its ligand-binding characteristics and downstream signaling pathways. These studies can lead to insights into the pharmacological modulation of PTH1R, paving the way for novel treatments for calcium-related disorders. Moreover, the generation of PTH1R recombinant proteins serves as a platform for high-throughput screening of small molecules, which may identify new drug candidates that specifically target this receptor. Overall, the investigation of PTH1R recombinant proteins is crucial for advancing our understanding of mineral homeostasis and developing innovative therapeutic strategies for related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US