Analytical Data
-
Gene name
SRRM2
- Application
-
Alternative Names
SRRM2；KIAA0324；SRL300；SRM300；Serine/arginine repetitive matrix Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UQ35
-
Expression Region
1666-2089aa
-
AA Sequence
RTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSR
-
Molecular Weight
53.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRRM2 (serine/arginine-rich splicing factor 2) is a critical protein involved in the regulation of pre-mRNA splicing, a vital process for gene expression and cellular function. As a member of the serine-arginine-rich (SR) protein family, SRRM2 plays a key role in the assembly of spliceosomal complexes, influencing alternative splicing decisions that define protein diversity in eukaryotic organisms. Research has shown that SRRM2 is not only essential for neuronal development but also implicated in various diseases, including cancer and neurodegenerative disorders. Its dysregulation can lead to aberrant splicing events, which may contribute to tumorigenesis or neurodegeneration. Understanding the structural and functional properties of SRRM2 is crucial for elucidating its role in splicing regulation and its potential as a therapeutic target. Recombinant SRRM2 protein is increasingly being utilized in research to explore its interactions with RNA and other splicing factors, thereby providing insights into the molecular mechanisms underlying splicing and associated pathologies. This research is paving the way for novel approaches to manipulate splicing processes in therapeutic contexts, making SRRM2 a protein of significant interest in both basic and applied molecular biology.
