Analytical Data
-
Gene name
PAK5
- Application
-
Alternative Names
PAK5；KIAA1264；PAK7；Serine/threonine-Protein kinase PAK 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TB93
-
Expression Region
1-293aa
-
AA Sequence
MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ
-
Molecular Weight
34.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The PAK5 gene, part of the p21-activated kinase (PAK) family, plays a crucial role in various cellular processes, including cell proliferation, survival, and cytoskeletal reorganization. This serine/threonine kinase is particularly noted for its involvement in neuronal development and function, making it significant for understanding neurodevelopmental disorders and neurodegenerative diseases. PAK5 is regulated by small GTPases such as Cdc42 and Rac1, which link it to signaling pathways crucial for cell migration and morphology. In recent years, research has increasingly focused on the implications of PAK5 dysregulation in cancer biology, where it has been associated with tumor progression and metastasis. Moreover, its role in synaptic plasticity highlights its importance in memory and learning processes. Studying PAK5 through recombinant protein techniques allows researchers to elucidate its biochemical properties, signaling mechanisms, and interaction with other proteins. This understanding not only contributes to the fundamental knowledge of cellular signaling but also offers insights into potential therapeutic targets for diseases linked to PAK5 malfunction, aiming to mitigate the effects of its dysregulation in both neurological conditions and cancer.
