Analytical Data
-
Gene name
POLR2A
- Application
-
Alternative Names
DNA directed RNA polymerase II A; DNA-directed RNA polymerase II largest subunit RNA polymerase II 220 kd subunit; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase II subunit RPB1; DNA-directed RNA polymerase III largest subunit; hRPB220; hsRPB1; POLR2; Polr2a; POLRA; Polymerase (RNA) II (DNA directed) polypeptide A 220kDa; Polymerase (RNA) II (DNA directed) polypeptide A; RNA polymerase II subunit B1; RNA-directed RNA polymerase II subunit RPB1; RPB1; RPB1_HUMAN; RPBh1; RpIILS; RPO2; RPOL2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24928
-
Expression Region
1-110 aa
-
AA Sequence
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCV
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POLR2A, a core component of RNA polymerase II, plays a critical role in the transcription of protein-coding genes in eukaryotic cells. As part of the larger RNA polymerase II complex, POLR2A is responsible for synthesizing mRNA precursors and essential non-coding RNAs required for various cellular functions. Research into POLR2A and its recombinant protein offers valuable insights into the molecular mechanisms governing gene expression and transcription regulation. Given its central role, abnormalities in POLR2A function have been linked to a range of diseases, including cancers and neurodegenerative disorders. The production of recombinant POLR2A enables scientists to study its biochemical properties, interactions with transcription factors, and its regulation by post-translational modifications. Furthermore, recombinant POLR2A can be utilized in high-throughput screening assays, aiding the discovery of novel therapeutics targeting transcriptional dysregulation. Understanding POLR2A at the molecular level not only deepens our knowledge of fundamental biological processes but also supports the development of innovative strategies for disease intervention and gene therapy. As such, the study of POLR2A recombinant protein represents a vital avenue of research in molecular biology and medicine.
