Analytical Data
-
Gene name
NPDC1
- Application
-
Alternative Names
NPDC1；Neural proliferation differentiation and control Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQX5
-
Expression Region
35-181aa
-
AA Sequence
GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRR PPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFS ARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDH HHHHH
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPDC1 (Neural Precursor Cell-Expressed Developmentally Down-Regulated 1) is an intriguing protein that has garnered substantial interest in the field of molecular biology and neuroscience. Originally identified as a factor involved in the development of neural precursor cells, NPDC1 plays a crucial role in regulating neuronal differentiation and proliferation. Research has indicated that NPDC1 expression is tightly controlled during neural development and may have implications in various neurological disorders. Notably, levels of this protein have been found to be altered in conditions such as Alzheimer's disease and other neurodegenerative disorders, suggesting its potential as a biomarker or therapeutic target. Recent advancements in recombinant protein production technologies have enabled researchers to produce NPDC1 in a more efficient and stable manner, facilitating detailed studies on its structure and function. Understanding the molecular mechanisms by which NPDC1 influences neuronal development and pathology could provide valuable insights into neuronal health, uncover new therapeutic avenues, and ultimately contribute to the development of targeted treatments for neurodegenerative diseases. Thus, the research on NPDC1 recombinant protein encompasses a promising frontier in neuroscience, with potential applications in both basic research and clinical settings.
