Analytical Data
-
Gene name
PLXNA2
- Application
-
Alternative Names
Plexin-A2; PlexinA2 ; PLXA2; PLXA2_HUMAN; PLXNA2; Semaphorin receptor OCT
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75051
-
Expression Region
1-164 aa
-
AA Sequence
MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
-
Molecular Weight
43.78 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLXNA2 (Plexin A2) is a significant member of the Plexin family of receptors, which play a crucial role in the regulation of various biological processes, including neuronal guidance, immune response, and cancer progression. Research has shown that PLXNA2 functions as a receptor for semaphorins, a class of secreted proteins involved in directing the development of the nervous system. Abnormal expression or mutations in PLXNA2 have been associated with various neurological disorders and certain cancers, highlighting its potential as a therapeutic target. The recombinant PLXNA2 protein is extensively studied to elucidate its structural characteristics, signaling pathways, and biological functions. By producing this protein in a laboratory setting, researchers aim to investigate its interactions with semaphorins and other binding partners, providing insights into molecular mechanisms that underlie its physiological roles. Furthermore, PLXNA2's involvement in axon guidance and its implications in tumor biology have made it a focal point for novel therapeutic strategies, including targeted drug development. Understanding the functional dynamics of PLXNA2 through recombinant protein studies can pave the way for innovative treatments in neurodegenerative diseases and cancer, making this research critically important in the fields of molecular biology and translational medicine.
