Analytical Data
-
Gene name
KIR2DS3
- Application
-
Alternative Names
KIR2DS3；NKAT7；Killer cell immunoglobulin-like receptor 2DS3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14952
-
Expression Region
22-245aa
-
AA Sequence
HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
-
Molecular Weight
26.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DS3 is an activating receptor belonging to the Killer Immunoglobulin-like Receptor (KIR) family, which plays a crucial role in the immune response mediated by natural killer (NK) cells. Research on KIR2DS3 has garnered significant interest due to its involvement in recognizing specific ligands on target cells, a function essential for the regulation of immune surveillance and response against tumors and viral infections. Unlike its inhibitory counterparts, KIR2DS3 enhances the cytotoxic activity of NK cells, making it a potential target for therapeutic strategies in cancer immunotherapy. Studies have shown that the expression patterns of KIR2DS3 may vary among different populations and in various pathological conditions, influencing the susceptibility to diseases and the efficacy of immunotherapies. The production of recombinant KIR2DS3 proteins enables researchers to investigate their structures, interactions with ligands, and downstream signaling pathways in greater detail. Understanding these aspects not only contributes to the broader field of immunology but also aids in the development of novel strategies aimed at harnessing NK cell activity for therapeutic purposes. As a result, the study of KIR2DS3 and its recombinant forms is pivotal in advancing our knowledge of immune regulation and enhancing therapeutic interventions against malignancies and infectious diseases.
