Analytical Data
-
Gene name
MRJP1
- Application
-
Alternative Names
MRJP1；Major royal jelly Protein 1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O18330
-
Expression Region
20-432aa
-
AA Sequence
NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL
-
Molecular Weight
48.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRJP1 (major royal jelly protein 1) is a key protein found in royal jelly, a substance produced by honeybees that is crucial for the growth and development of bee larvae and the maintenance of the queen bee. Due to its unique biochemical properties, MRJP1 has garnered attention in both apiculture and biomedical research. Studies suggest that MRJP1 possesses various health benefits, including anti-inflammatory, antioxidant, and immunomodulatory effects, which may contribute to its potential therapeutic applications in human health. In recent years, recombinant DNA technology has enabled the production of MRJP1 in various expression systems, such as yeast and bacteria, facilitating more accessible and cost-effective research. This approach allows for the large-scale production of the protein, enabling in-depth studies of its properties and effects. Moreover, understanding the molecular mechanisms through which MRJP1 exerts its biological functions could pave the way for developing new treatments for several diseases. The ongoing investigation into MRJP1's structure-function relationships and its interactions with various biological pathways continues to reveal insights into its significance, not only in the context of honeybee biology but also in potential applications in medicine and nutraceuticals.
