Analytical Data
-
Gene name
fno
- Application
-
Alternative Names
fno;F420-dependent NADP reductase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
D9PVP5
-
Expression Region
1-224aa
-
AA Sequence
MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE
-
Molecular Weight
28.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FNO (Fused Nucleotide Oligomerization) protein is an emerging focus of research in molecular biology due to its unique structural and functional properties. These proteins play critical roles in various biological processes, including signal transduction, cellular communication, and metabolic pathways. The study of FNO proteins has gained momentum as scientists seek to understand their mechanisms of action and potential applications in biotechnology and medicine. Recent advances in high-throughput sequencing and protein engineering techniques have enabled researchers to explore the diverse functions of FNO proteins in different organisms, revealing their involvement in disease pathways and cellular stress responses. Additionally, the potential for FNO proteins to serve as valuable tools for synthetic biology applications and therapeutic interventions has spurred interest in optimizing their stability and activity. Understanding the evolutionary relationships and functional diversity among FNO proteins is crucial for harnessing their capabilities in developing novel biocatalysts and targeted therapies. As research continues to uncover the intricate roles of FNO proteins, it holds promise for innovative solutions to some of the most pressing challenges in health and environmental sustainability.











