Analytical Data
-
Gene name
NPTN
- Application
-
Alternative Names
NPTN；SDFR1；Neuroplastin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y639
-
Expression Region
29-220aa
-
AA Sequence
QNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSAT RKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHK RSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINK ENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHVDHHHHHH
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPTN (Neuronal Pentraxin 2) is a protein that plays a critical role in synaptic function and neuronal communication, making it a significant focus of neuroscience research. Its involvement in the formation and maturation of synapses has drawn interest, particularly in the context of neurodegenerative diseases and psychiatric disorders. Studies have indicated that NPTN is implicated in synaptic plasticity, which is essential for learning and memory. Understanding the structural and functional aspects of NPTN can provide insights into its role in neural connectivity and associated cognitive processes. With the advancement of recombinant protein technology, researchers have been able to produce and purify NPTN for detailed studies, including its interactions with other synaptic proteins and its influence on neurotransmitter release. This research is crucial for elucidating the mechanisms underlying synaptic dysfunctions and may pave the way for potential therapeutic strategies in treating neurodevelopmental and neurodegenerative conditions. By investigating the properties of recombinant NPTN, scientists aim to uncover its biological significance and contribute to the broader understanding of neuronal health and disease.
