Analytical Data
-
Gene name
Bit1
- Application
-
Alternative Names
PTRH2; BIT1; Peptidyl-tRNA hydrolase 2; mitochondrial; PTH 2; EC 3.1.1.29; Bcl-2 inhibitor of transcription
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3E5
-
Expression Region
1-179aa
-
AA Sequence
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
-
Molecular Weight
45.43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Bit1, a novel recombinant protein, has garnered significant attention in the field of molecular biology due to its unique properties and potential applications in various biotechnological domains. First identified in the context of studying pathogen interactions, Bit1 is thought to play a critical role in enhancing cellular responses to stress and modulating immune system functions. Research has indicated that Bit1 may be involved in promoting cell survival and proliferation, particularly under conditions that typically induce apoptosis, thus making it a candidate for therapeutic interventions in diseases characterized by excessive cell death, such as neurodegenerative disorders and certain cancers. The exploration of Bit1's molecular mechanisms has opened up avenues for developing innovative strategies in drug design and regenerative medicine. By utilizing recombinant DNA technology, scientists are working to produce Bit1 in sufficient quantities for detailed functional studies, aiming to elucidate its role in cellular signaling pathways. Furthermore, understanding Bit1's interactions with other cellular proteins could provide insights into its potential as a target for enhancing immune responses or developing novel vaccines. As research progresses, the implications of Bit1 in health and disease continue to grow, warranting further investigation into its therapeutic applications and its role in biological systems. This ongoing research represents a promising frontier in the understanding of protein functions and their impact on human health.
