Analytical Data
-
Gene name
Sprr2b
- Application
-
Alternative Names
Sprr2b；Small proline-rich Protein 2B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35325
-
Expression Region
1-72aa
-
AA Sequence
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
-
Molecular Weight
12.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Sprr2b, a member of the small proline-rich protein (SPRR) family, is primarily expressed in epithelial tissues and plays a crucial role in cellular processes such as proliferation, differentiation, and stress response. Research into Sprr2b has gained attention due to its involvement in various physiological and pathological conditions, including skin development and inflammatory diseases. Studies have suggested that Sprr2b may contribute to the structural integrity of the epithelial barrier, making it essential in protecting tissues from environmental stressors and pathogens. Moreover, aberrations in Sprr2b expression have been associated with skin disorders, such as psoriasis and atopic dermatitis, highlighting its potential as a biomarker for these conditions. Investigating the biochemical properties of Sprr2b, particularly its interactions with other proteins and its role in signaling pathways, could provide valuable insights into its functional mechanisms. Furthermore, understanding the regulatory mechanisms governing Sprr2b expression may open new avenues for therapeutic interventions in skin-related diseases. Overall, the exploration of Sprr2b as a recombinant protein presents an opportunity to elucidate its biological significance and therapeutic potential in dermatological research.
