Analytical Data
-
Gene name
Plaa
- Application
-
Alternative Names
Plaa；PLAP；Phospholipase A-2-activating Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27612
-
Expression Region
495-584aa
-
AA Sequence
TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC
-
Molecular Weight
13.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Plaa, or Phospholipase A2-activated protein, is a pivotal component in various biological processes, including inflammation, cell signaling, and membrane dynamics. This protein has garnered significant attention in recent years due to its role in modulating cellular responses to external stimuli. Research into Plaa's structure and function has revealed its involvement in the mechanisms of disease, particularly in cancer and neurodegenerative disorders, where its dysregulation can lead to pathological outcomes. The study of Plaa encompasses a multidisciplinary approach, combining biochemistry, molecular biology, and biophysics to elucidate its interactions with phospholipids and other cellular components. As scientists seek to understand the precise mechanisms through which Plaa exerts its effects, the potential for therapeutic applications becomes increasingly apparent. By targeting Plaa's pathways or modulating its activity, researchers aim to develop novel strategies for intervention in diseases characterized by inflammation and cell dysfunction. Thus, the ongoing exploration of Plaa not only contributes to the fundamental understanding of cellular biology but also holds promise for innovative treatments in the realm of medicine.
