Analytical Data
-
Gene name
BET1
- Application
-
Alternative Names
BET1; BET1 homolog; hBET1; Golgi vesicular membrane-trafficking Protein p18
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15155
-
Expression Region
1-118aa
-
AA Sequence
MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR
-
Molecular Weight
38.72 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BET1, or "Bromodomain and Extra-Terminal domain 1," is a crucial protein involved in a variety of cellular processes, including transcriptional regulation, chromatin remodeling, and the response to stress. Research into BET1 and its interactions has gained momentum due to its role in cancer, inflammation, and other diseases. BET proteins are known to recognize acetylated lysine residues on histones and non-histone proteins, which positions them as integral regulators of gene expression. The dysregulation of BET family proteins has been linked to various pathological conditions, making them promising targets for therapeutic intervention. Recent studies have focused on the structural and functional aspects of BET1, probing its potential as a biomarker and a therapeutic candidate. Researchers have been employing innovative strategies to develop BET1-targeting small molecules and inhibitors that may modulate its activity, offering new avenues for treating cancers and inflammatory diseases. Understanding the molecular mechanisms of BET1 reorganization and its regulatory role in key cellular pathways remains a crucial area of study, paving the way for novel strategies in drug discovery and personalized medicine.
