Analytical Data
-
Gene name
Beta-Galactosidase
- Application
-
Alternative Names
GALCERase;Galactocerebroside beta-galactosidase;Galactosylceramidase;Galactosylceramide beta-galactosidase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54803
-
Expression Region
43-685aa
-
AA Sequence
LVPRGSYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFTSGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEATR
-
Molecular Weight
75.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Beta-galactosidase is an important enzyme widely studied for its role in the hydrolysis of lactose into glucose and galactose, which has significant implications in dairy industry applications and biotechnology. Recombinant beta-galactosidase is produced through genetic engineering techniques, where the gene encoding the enzyme is cloned into a suitable expression system, such as bacteria, yeast, or mammalian cells. The research surrounding recombinant beta-galactosidase focuses on enhancing its activity, stability, and specificity, enabling more efficient lactose breakdown, which is particularly beneficial for lactose-intolerant individuals. Additionally, the enzyme's ability to cleave beta-galactosidic bonds has potential applications in various fields including food processing, biofuel production, and pharmaceuticals. Advances in protein engineering and synthetic biology are driving innovations, leading to the development of engineered variants with improved characteristics. Understanding the enzyme's structure-function relationship and optimizing its production processes are key aspects of ongoing research, aiming to provide sustainable solutions and enhance the economic viability of biotechnological applications.
