Analytical Data
-
Gene name
COQ7
- Application
-
Alternative Names
COQ7；5-demethoxyubiquinone hydroxylase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99807
-
Expression Region
37-217aa
-
AA Sequence
SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKM WDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMA CTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGL DHDAELAPAYAVLKSIIQAGCRVAIYLSERLVDHHHHHH
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COQ7 is an essential enzyme involved in the biosynthesis of coenzyme Q10 (CoQ10), a critical component of the mitochondrial electron transport chain that is vital for ATP production and cellular energy metabolism. Mutations in the COQ7 gene can lead to several mitochondrial disorders and have been implicated in conditions such as ataxia, cardiomyopathy, and neurodegenerative diseases. Given the importance of CoQ10 in cellular function and its potential therapeutic applications, the study of recombinant COQ7 protein has garnered significant interest in the field of biomedical research. The production and characterization of recombinant COQ7 allow for detailed investigations into its enzymatic activity, structure-function relationships, and interactions with other components of the CoQ biosynthetic pathway. Moreover, understanding COQ7's role in mitochondrial health can contribute to the development of targeted therapies for diseases related to CoQ10 deficiency. Therefore, research on recombinant COQ7 not only enhances our comprehension of mitochondrial biology but also holds promise for the advancement of clinical interventions aimed at alleviating the burden of related metabolic disorders.
