Analytical Data
-
Gene name
PRKN
- Application
-
Alternative Names
PRKN；PARK2；E3 ubiquitin-Protein ligase parkin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60260
-
Expression Region
1-465aa
-
AA Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
-
Molecular Weight
55.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRKN (Parkin RBR E3 Ubiquitin Protein Ligase) is a crucial protein encoded by the PARK2 gene, primarily known for its role in the ubiquitin-proteasome system, which regulates protein degradation and quality control within cells. Mutations in the PARK2 gene are linked to early-onset Parkinson's disease, a neurodegenerative disorder characterized by motor dysfunction, tremors, and cognitive decline. Research on PRKN has gained significant attention due to its potential as a therapeutic target for neurodegenerative diseases. The protein is involved in various cellular processes, including mitochondrial quality control, autophagy, and the regulation of apoptosis. Defective PRKN function impairs these processes, leading to cellular stress and neuronal death, thereby exacerbating disease progression. Studies have shown that PRKN facilitates the tagging of damaged mitochondria for degradation, underscoring its role in maintaining cellular health. Recent efforts have focused on characterizing the biochemical mechanisms underlying PRKN's activity, revealing its interaction with various cellular partners and pathways. Understanding the structural and functional aspects of PRKN is essential for developing potential interventions that could ameliorate or prevent the onset of Parkinson's disease. Overall, ongoing research into PRKN and its role in cellular homeostasis may pave the way for novel therapeutic strategies that address the underlying causes of neurodegenerative diseases, promoting neuronal survival and improving patient outcomes.
