Analytical Data
-
Gene name
CTRB1
- Application
-
Alternative Names
CTRB1；CTRB；Chymotrypsinogen B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17538
-
Expression Region
19-263aa
-
AA Sequence
CGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISED WVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVN NDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANK TPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLV CQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAANVDHHH HHH
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTRB1 (Carboxypeptidase B1) is a key enzyme involved in the regulatory mechanisms of various physiological processes, including digestion, metabolism, and neurotransmission. It functions by cleaving carboxy-terminal amino acids from peptides and proteins, thereby playing a vital role in the activation and inactivation of bioactive molecules. Dysregulation of CTRB1 has been linked to several pathological conditions, such as pancreatitis and various metabolic disorders. Recent studies have shown that CTRB1 may also influence inflammatory responses and the immune system, highlighting its potential as a therapeutic target. The production of recombinant CTRB1 protein has thus gained significant interest, as it allows for in-depth characterization of its biochemical properties, enzymatic activity, and interactions with other biomolecules. This research can facilitate the development of novel interventions for diseases associated with aberrant CTRB1 activity and advance our understanding of its role in health and disease. The recombinant form of CTRB1 can be utilized in diverse applications, including drug discovery, diagnostic assays, and the development of enzyme inhibitors, further underscoring its importance in biomedical research.
