Analytical Data
-
Gene name
BEND7
- Application
-
Alternative Names
BEND7; C10orf30; BEN domain-containing Protein 7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N7W2
-
Expression Region
1-365aa
-
AA Sequence
MRRLLNDSTGRIYQRVGKEGEKLKEEPQDLDLVWPPRLNSSAEAPQSLHPSSRGVWNELPPQSGQFSGQYGTRSRTFQSQPHPTTSSNGMVVNKHSEGSHGGELPVVNSSAGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRTAVSRKRNKKKKVPPKTVEPLTVKQKPSGSEMEKKSVVASELSALQAAEHTSPEESRVLGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSEIADSDERLDGIALPPTVV
-
Molecular Weight
66.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BEND7, a member of the BEND (Bernardinelli, A, and P) protein family, has garnered attention due to its potential roles in cellular processes and disease mechanisms. Initial studies established BEND7's involvement in transcriptional regulation and chromatin organization, suggesting its significance in gene expression modulation. Recent research indicates that BEND7 may play critical roles in development, cellular differentiation, and apoptosis, positions it as a pivotal factor in various biological pathways. Additionally, abnormal expression of BEND7 has been linked to several pathological conditions, including cancer and neurodegenerative diseases, highlighting its potential as a therapeutic target. Investigating the structure and function of BEND7 will deepen our understanding of its biological roles and could pave the way for novel interventions in diseases associated with its dysregulation. Overall, the study of BEND7 recombinant proteins is vital for elucidating its mechanisms of action and enhancing our grasp of the complexities of gene regulation and cellular homeostasis.
