Cat: PA1000-3747

Recombinant Human CD30L Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD30L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD30L;CD30L;Tumor necrosis factor ligand superfamily member 8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P32971

  • Expression Region

    63-234aa

  • AA Sequence

    QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTK LSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLEL LINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQ YIDTSTFPLENVLSIFLYSNSD

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD30 ligand (CD30L), a member of the tumor necrosis factor (TNF) superfamily, is primarily expressed on activated T cells and plays a critical role in immune response regulation and cell differentiation. Its interaction with the CD30 receptor, found on various immune cells, is essential for promoting cell survival, proliferation, and cytokine production, making it a significant player in inflammatory diseases and certain malignancies. Abnormal expression of CD30 and CD30L has been implicated in various pathologies, including autoimmunity and cancer, particularly in lymphoproliferative disorders like Hodgkin’s lymphoma. Research on recombinant CD30L has gained momentum due to its potential therapeutic applications. By producing CD30L in a recombinant form, scientists aim to study its biological functions, elucidate its signaling pathways, and explore its role in modulating immune responses. Furthermore, recombinant CD30L can be utilized as a targeted therapy to enhance anti-tumor immunity by activating CD30-expressing cells or inhibiting the growth of tumors that exploit the CD30 signaling pathway for survival. Understanding the intricacies of CD30L and its interactions could lead to innovative treatment strategies, enhancing the effectiveness of existing therapies or providing alternatives for patients with malignancies that have limited treatment options. Thus, the investigation of CD30L recombinant protein not only contributes to fundamental immunology but also holds promise for the development of novel immunotherapies aimed at harnessing the body's immune system to combat cancer and other diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US