Analytical Data
-
Gene name
BEND5
- Application
-
Alternative Names
BEN domain-containing Protein 5; Bend5; BEND5_HUMAN; C1orf165; chromosome 1 open reading frame 165; FLJ11588
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L4P6
-
Expression Region
1-252aa
-
AA Sequence
MDSLEDAVVPRALYEELLRNYQQQQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSGIWVDEEKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAVPKPPLSPHKLSIVRECLYDRIAQETVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNLQ
-
Molecular Weight
55.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BEND5, a member of the BEND protein family, has garnered significant attention in recent years due to its potential role in various cellular processes, including transcriptional regulation and chromatin remodeling. Initial studies have suggested that BEND5 may be involved in crucial biological functions such as cell growth, differentiation, and the modulation of immune responses. Given its expression in several tissues, understanding the structural and functional characteristics of BEND5 is pivotal for elucidating its contributions to health and disease. Recent advances in recombinant protein technology have facilitated the production of BEND5 in heterologous systems, allowing researchers to investigate its structure-function relationships in detail. This approach not only enhances our understanding of BEND5’s biological roles but also provides insights into its possible implications in pathological conditions, including cancer and autoimmune diseases. The ongoing research into the recombinant expression and characterization of BEND5 is expected to yield valuable knowledge that could lead to novel therapeutic strategies targeting pathways where BEND5 is implicated.
