Analytical Data
-
Gene name
BCAP29
- Application
-
Alternative Names
BCAP29; BAP29; B-cell receptor-associated Protein 29; BCR-associated Protein 29; Bap29
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHQ4
-
Expression Region
1-241aa
-
AA Sequence
MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
-
Molecular Weight
54.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BCAP29, or B-cell receptor-associated protein 29, is a pivotal protein implicated in various cellular processes, particularly in B-cell signaling and development. It functions as a signaling adapter and plays crucial roles in modulating immune responses, especially in the context of B-cell receptor (BCR) signaling pathways. The BCAP29 protein has garnered attention in research due to its involvement in several pathological conditions, including autoimmune diseases and cancers. Given the central role of B-cells in adaptive immunity, understanding the intricate mechanisms of BCAP29 function is essential for developing targeted therapies. Researchers have embarked on studies to explore the structural properties, interaction networks, and regulatory mechanisms of BCAP29, often utilizing recombinant protein techniques. These studies aim to elucidate its biochemical properties and functional relevance in B-cell activation and lymphocyte biology. By producing recombinant BCAP29, scientists can investigate its interactions with other signaling molecules, assess its role in promoting B-cell proliferation, differentiation, and survival, and explore its potential as a therapeutic target. As a result, the study of BCAP29 not only contributes to the fundamental understanding of immunology but also presents opportunities for developing novel interventions for diseases where B-cell dysregulation is a prominent feature.
