Cat: PA1000-3577

Recombinant Human TYRO3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TYRO3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TYRO3;BYK;Tyrosine-Protein kinase receptor TYRO3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q06418

  • Expression Region

    455-890aa

  • AA Sequence

    RKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDEL KEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKA DIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILP FMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHR DLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESL ADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQP PECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLY INIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPG GLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC

  • Molecular Weight

    77 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TYRO3, a member of the TAM receptor tyrosine kinase family, plays a crucial role in various physiological processes, including the regulation of immune responses, neuronal development, and tissue homeostasis. Research has indicated that TYRO3 is involved in the clearance of apoptotic cells and the modulation of inflammation, highlighting its potential as a therapeutic target in various diseases, such as cancer, autoimmune disorders, and neurodegenerative conditions. The interest in recombinant TYRO3 protein stems from its functional significance and the necessity to elucidate the molecular mechanisms underlying its signaling pathways. Recombinant expression systems enable the production of highly purified TYRO3 protein, facilitating structural and functional studies. Understanding the interactions of TYRO3 with its ligands and downstream signaling partners can provide insights into its role in cellular processes and disease mechanisms. Additionally, the potential for developing TYRO3-based therapeutics, including monoclonal antibodies or small molecules, makes studying this protein particularly important in the context of drug development. Overall, the research on TYRO3 recombinant protein paves the way for advancements in therapeutic strategies that aim to manipulate its signaling pathways for beneficial clinical outcomes.


E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US