Analytical Data
-
Gene name
BARX1
- Application
-
Alternative Names
BARX1Homeobox Protein BarH-like 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HBU1
-
Expression Region
1-100aa
-
AA Sequence
MGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BARX1, a member of the BarH-like homeobox gene family, plays a crucial role in various developmental processes and tissue differentiation. Its expression is predominantly observed in the developing nervous system, limbs, and other organs, highlighting its significance in embryonic development. Recent studies have suggested that BARX1 may also be involved in cellular processes related to cancer progression and metastasis, making it a target of increasing interest in oncological research. The previous findings have indicated that BARX1 can influence cell proliferation, apoptosis, and migratory behavior, suggesting its potential role as a tumor suppressor. However, the mechanisms underlying BARX1's function at the molecular level remain largely unexplored. The recombination and expression of BARX1 as a recombinant protein offer a promising approach to elucidate its function, enabling researchers to investigate its interactions with other proteins, transcriptional activity, and role in relevant signaling pathways. Understanding the biochemical properties of BARX1 through recombinant technology could contribute significantly to the field of developmental biology and cancer research, potentially leading to novel therapeutic strategies targeting BARX1-related pathways. As such, BARX1 recombinant protein research is pivotal in advancing our understanding of its biological roles and therapeutic implications.
