Analytical Data
-
Gene name
GHRH
- Application
-
Alternative Names
GHRH；GHRF；Somatoliberin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01286
-
Expression Region
19-108aa
-
AA Sequence
CSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQE RGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Growth Hormone-Releasing Hormone (GHRH) is a pivotal peptide that regulates the secretion of growth hormone (GH) from the pituitary gland, playing a crucial role in growth, metabolism, and overall endocrine function. The interest in recombinant GHRH research has grown significantly, particularly in understanding its potential therapeutic applications. Initial studies focused on its role in treating growth disorders, particularly in children with growth hormone deficiencies. The advent of recombinant DNA technology has facilitated the production of GHRH in large quantities, allowing researchers to study its pharmacokinetics, pharmacodynamics, and safety profiles more effectively. Furthermore, GHRH has garnered attention for its potential implications beyond growth regulation, including its effects on metabolism, immune function, and even neuroprotection. Investigations into GHRH analogs have demonstrated enhanced efficacy and stability, leading to innovative treatments for conditions such as obesity, frailty, and age-related decline in GH levels. As research continues to unveil the complexities of GHRH signaling pathways, the therapeutic prospects for recombinant GHRH and its derivatives continue to expand, positioning it as a promising candidate in the field of regenerative medicine and hormone replacement therapies. Overall, the exploration of recombinant GHRH represents a significant frontier in endocrinology, offering hope for improved health outcomes across various populations.
