Analytical Data
-
Gene name
B4GALT2
- Application
-
Alternative Names
B4GALT2; Beta-1.4-galactosyltransferase 2; Beta-1.4-GalTase 2; Beta4Gal-T2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60909
-
Expression Region
1-372aa
-
AA Sequence
MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B4GALT2, or Beta-1,4-galactosyltransferase 2, is an important enzyme involved in the glycosylation process, specifically in the synthesis of glycoproteins and glycolipids. This enzyme is responsible for transferring galactose residues to nascent carbohydrate chains, a crucial step that affects the structure and function of various biomolecules. Research has shown that B4GALT2 plays a significant role in cell signaling, adhesion, and immune response, highlighting its importance in both developmental and pathological contexts. Abnormal expression or dysfunction of B4GALT2 has been implicated in various diseases, including certain cancers and congenital disorders. Consequently, the study of B4GALT2, particularly through the use of recombinant protein techniques, has garnered increasing attention. Recombinant B4GALT2 can be produced in controlled laboratory settings, allowing for a deeper understanding of its enzymatic activity and interaction with substrates. This research not only paves the way for potential therapeutic strategies targeting glycosylation pathways but also enhances our overall understanding of carbohydrate biology and its implications in health and disease. As such, the characterization and functional analysis of B4GALT2 recombinant protein represent a significant area of interest in molecular biology, biochemistry, and therapeutic development.
