Analytical Data
-
Gene name
CD40
- Application
-
Alternative Names
CD40；TNFRSF5；Tumor necrosis factor receptor superfamily member 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25942
-
Expression Region
21-193aa
-
AA Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETK DLVVQQAGTNKTDVVCGPQDRLR
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD40 is a costimulatory protein found on antigen-presenting cells and plays a crucial role in the immune response by facilitating communication between these cells and T cells. Its interaction with CD40 ligand (CD40L) on T cells enhances the activation, proliferation, and survival of B cells, leading to antibody production and immune memory formation. Given its pivotal role in regulating humoral immunity, CD40 and its signaling pathways have become attractive targets for therapeutic interventions in various diseases, including cancers, autoimmune disorders, and infectious diseases. Research into recombinant CD40 proteins involves engineering these molecules for enhanced functionality, stability, and delivery. Such advancements could improve vaccine efficacy, boost immune responses in cancer therapies, and help in the development of monoclonal antibodies. Furthermore, understanding the structural and functional properties of CD40 can provide insights into its biological mechanisms and potentially reveal new avenues for manipulating immune responses for therapeutic benefit. The ongoing study of CD40 recombinant proteins not only promises to advance basic immunology but also holds significant potential for influencing future clinical applications in immunotherapy and vaccine development.
