Analytical Data
-
Gene name
ZCCHC17
- Application
-
Alternative Names
ZCCHC17；PS1D；Zinc finger CCHC domain-containing Protein 17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NP64
-
Expression Region
1-241aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMNSGRPETMENLPALYTIFQGEVAMVT DYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK NDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEA VLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPD PTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAK KKKKKKKHKKKHKE
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCCHC17 is a member of the ZCCHC family of zinc finger proteins known for their roles in various cellular processes, including RNA manipulation and regulation. Recent studies suggest that ZCCHC17 is involved in critical pathways related to RNA splicing and stability, potentially impacting gene expression and cellular responses to stress. Given its implications in RNA metabolism, ZCCHC17 has garnered interest for its potential role in diseases such as cancer and neurodegenerative disorders, where dysregulation of RNA processing is a common feature. The recombination and purification of ZCCHC17 protein allow researchers to investigate its structural and functional characteristics in detail, facilitating a better understanding of its biological role. Understanding ZCCHC17’s mechanisms can provide insights into its potential as a therapeutic target. The exploration of ZCCHC17’s interactions with RNA and other cellular molecules can reveal novel pathways for intervention in diseases where this protein plays a significant role. Overall, ongoing research aims to elucidate the molecular mechanisms and biological significance of ZCCHC17, contributing to a broader understanding of RNA biology and its implications in health and disease.
