Cat: PA1000-3502

Recombinant Human XRCC3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    XRCC3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    XRCC3;DNA repair Protein XRCC3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43542

  • Expression Region

    1-346aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMDLDLLDLNPRIIAAIKKAKLKSVKEVLHF SGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQ RLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQH GGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAP RARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERV SPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSY TISAEGVRGTPGTQSH

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

XRCC3, a member of the X-ray repair cross-complementing (XRCC) family, plays a crucial role in the repair of DNA double-strand breaks through homologous recombination, a vital mechanism for maintaining genomic stability. Its importance is underscored by its involvement in the repair processes initiated by ionizing radiation and various genotoxic agents, which can lead to cellular damage and increased mutation rates. Mutations or deficiencies in the XRCC3 gene have been implicated in a range of pathological conditions, including cancer susceptibility and sensitivity to chemotherapeutic agents. Given the pivotal role of XRCC3 in DNA repair, researchers have focused on characterizing its protein structure, functional domains, and interactions with other proteins involved in the repair pathway. Recombinant XRCC3 protein studies have enabled the investigation of its biochemical properties, regulatory mechanisms, and potential as a therapeutic target. By understanding the specific roles and actions of XRCC3, insights into cancer treatments and personalized medicine approaches may emerge, highlighting the significance of ongoing XRCC3 protein research in both basic and applied sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US