Analytical Data
-
Gene name
AUTS2
- Application
-
Alternative Names
Autism susceptibility gene 2 Protein; AUTS2; AUTS2_HUMAN; FBRSL2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXX7
-
Expression Region
108-198aa
-
AA Sequence
LKPQERVEKRQTPLTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQNSCRDSDSESASGESKGFH
-
Molecular Weight
35.75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AUTS2 (Autism Susceptibility Candidate 2) is a gene that has garnered significant attention due to its potential links to neurodevelopmental disorders, particularly autism spectrum disorders (ASD). Research suggests that mutations and alterations in the expression of AUTS2 may contribute to the pathology of these conditions, implicating the gene in neuronal development and synaptic function. The protein encoded by AUTS2 is believed to play a crucial role in the regulation of transcription and neural connectivity during brain development. Studies have indicated that AUTS2 interacts with various proteins involved in neuronal signaling and chromatin remodeling, highlighting its importance in gene regulation processes essential for cognitive functions. Understanding the functional implications of AUTS2 and the molecular mechanisms underlying its association with ASD is critical for developing targeted therapeutic strategies. As a result, research focused on the expression, regulation, and functional characterization of AUTS2 recombinant protein aims to elucidate its role in neural circuitry and the wider implications for brain disorders. The identification of precise pathways and interactions involving AUTS2 may offer insights into the genetic underpinnings of autism and other related conditions, potentially leading to innovative approaches for prevention and treatment. Thus, the investigation into AUTS2 recombinant protein serves as a foundational step in bridging the gap between genetic predisposition and functional outcomes in neurodevelopmentally relevant contexts.
