Analytical Data
-
Gene name
VTCN1
- Application
-
Alternative Names
VTCN1；B7H4；V-set domain-containing T-cell activation inhibitor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z7D3
-
Expression Region
29-258aa
-
AA Sequence
FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
-
Molecular Weight
27.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VTCN1, also known as V-set domain containing T cell activation inhibitor 1, is a critical immune regulatory protein involved in the modulation of T cell responses. Its primary role is to inhibit T cell activation and promote immune tolerance, making it an important focus in cancer immunotherapy and autoimmune disease research. The dysregulation of VTCN1 has been associated with various malignancies, where tumor cells exploit this pathway to evade immune surveillance. Studies have shown that VTCN1 interacts with immune checkpoints, leading to the suppression of T cell activities. As a result, the recombinant production of VTCN1 protein has gained attention for its potential therapeutic applications. Researchers aim to create VTCN1-based agents that can either block its inhibitory effects to unleash anti-tumor immunity or enhance its function in cases of autoimmune disorders. Understanding the structural and functional properties of VTCN1 is essential for designing effective therapies, and ongoing investigations focus on its role in immune interaction networks. Overall, VTCN1’s significance in the immune landscape highlights the need for extensive research into its pathways and functions in various disease contexts.
