Cat: PA2000-1629

Recombinant Human TEAD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TEAD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TEAD1;TCF13;TEF1;Transcriptional enhancer factor TEF-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28347

  • Expression Region

    1-426aa

  • AA Sequence

    MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR KSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTF PGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPA PSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYS DPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFV YRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETL LCMACVFEVSNSEHGAQHHIYRLVKD

  • Molecular Weight

    52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TEAD1 (TEA Domain Transcription Factor 1) is a crucial transcription factor that plays a significant role in various biological processes, including cell proliferation, differentiation, and development. As a key mediator in the Hippo signaling pathway, TEAD1 interacts with the transcriptional co-activators Yes-associated protein (YAP) and transcriptional co-activator with PDZ-binding motif (TAZ), regulating gene expression and cellular responses to growth signals. Dysregulation of TEAD1 and its interactions has been implicated in various diseases, particularly in cancer, where it contributes to increased proliferative signaling and oncogenic transcriptional programs. As researchers strive to elucidate the molecular mechanisms underlying TEAD1's functions, the production of recombinant TEAD1 protein provides a valuable tool for structural and functional studies. By generating and characterizing this protein, scientists can investigate its binding affinities, post-translational modifications, and interactions with binding partners. This research not only enhances our understanding of TEAD1's role in cellular contexts but also paves the way for potential therapeutic interventions targeting TEAD1 signaling pathways in diseases associated with its dysregulation. Thus, the study of TEAD1 recombinant protein is foundational to bridging basic research and clinical applications, thereby highlighting its significance in the field of molecular biology and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US