Analytical Data
-
Gene name
VPS24
- Application
-
Alternative Names
VPS24；CGI149；Charged multivesicular body Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3E7
-
Expression Region
1-222aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHRKAVSKLYASKAHMNSVLMGMKNQLAVLRV AGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFES MDDQEEMEEEMGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQRE EEKVKRSVKDAAKKGQKDVCIVLAKEMIRSAEMEIDRILFEITAGALGKA PSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VPS24, a key component of the ESCRT-III complex, plays a crucial role in various cellular processes, including the sorting of ubiquitinated proteins, membrane remodeling, and the regulation of cell division. The ESCRT machinery is essential for the budding of viruses and the degradation of damaged organelles, making VPS24 an important protein for maintaining cellular homeostasis. Recent studies have highlighted its involvement in the pathogenesis of several diseases, including cancer and neurodegenerative disorders, where dysregulation of protein sorting and membrane trafficking is often observed. Given its vital functions, understanding the structure and mechanisms of VPS24 can provide insights into potential therapeutic targets. Researchers have focused on characterizing the restructured protein VPS24 to gain a deeper understanding of its interaction with other ESCRT components and its overall role in cellular dynamics. This research not only furthers our understanding of VPS24 itself but also contributes to the broader field of cellular biology, where insights into protein dynamics and interaction networks pave the way for advancements in disease treatment and prevention.
