Cat: PA1000-3455

Recombinant Human VEGF121 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VEGF121

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VEGF121;VEGF;Vascular endothelial growth factor A. long form

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15692-9

  • Expression Region

    27-147aa

  • AA Sequence

    APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR

  • Molecular Weight

    14 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Vascular endothelial growth factor (VEGF) is a key regulator of angiogenesis, playing a crucial role in both physiological and pathological processes, including wound healing, tumor growth, and retinal neovascularization. Among the various isoforms of VEGF, VEGF121 is notable for its potent angiogenic properties, as it lacks the heparin-binding domain, leading to its increased solubility and diffusion in tissues. This characteristic makes VEGF121 particularly interesting for therapeutic applications, especially in conditions where enhanced blood vessel formation is desired. Research has focused on the recombinant production of VEGF121 to explore its biological functions, optimize delivery methods, and evaluate its potential in regenerative medicine and cancer therapy. Furthermore, studies have demonstrated that VEGF121 can promote endothelial cell proliferation, migration, and survival, making it a candidate for interventions in ischemic diseases. However, the challenge remains to balance the angiogenic effects with potential adverse outcomes, such as edema or abnormal vessel formation. Thus, ongoing research aims to elucidate the molecular mechanisms of VEGF121 action and its therapeutic efficacy, paving the way for innovative treatments that harness the power of angiogenesis while mitigating associated risks.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US