Cat: PA2000-1582

Recombinant Human DEFb104 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DEFb104

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DEFb104;DEFB104;DEFB4;DEFB104B;Beta-defensin 104

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WTQ1

  • Expression Region

    1-72aa

  • AA Sequence

    MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP

  • Molecular Weight

    8.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DEFb104 is a recombinant protein that has garnered significant attention due to its potential therapeutic applications and its role in immune modulation. This protein is derived from the defensing family, which are small, cationic peptides known for their antimicrobial and immunoregulatory properties. Research into DEFb104 has focused on its mechanisms of action, structure, and potential benefits in treating various conditions, including infections and inflammatory diseases. Studies have shown that DEFb104 exhibits broad-spectrum antimicrobial activity, targeting a variety of pathogens, which makes it a candidate for developing novel antimicrobial therapies, especially in the face of rising antibiotic resistance. Additionally, its ability to influence immune responses positions DEFb104 as a potential agent in enhancing vaccine efficacy or acting as an immunotherapeutic agent in cancer treatment. Continued investigation into the stability, efficacy, and delivery methods of DEFb104 is essential to fully harness its therapeutic potential and address health challenges posed by resistant microbes and immune-related disorders. Overall, the exploration of DEFb104 highlights the intersection of protein engineering and clinical therapeutics, opening avenues for innovative treatments in infectious and inflammatory diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US