Analytical Data
-
Gene name
DEFb104
- Application
-
Alternative Names
DEFb104；DEFB104；DEFB4；DEFB104B；Beta-defensin 104
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WTQ1
-
Expression Region
1-72aa
-
AA Sequence
MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
-
Molecular Weight
8.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DEFb104 is a recombinant protein that has garnered significant attention due to its potential therapeutic applications and its role in immune modulation. This protein is derived from the defensing family, which are small, cationic peptides known for their antimicrobial and immunoregulatory properties. Research into DEFb104 has focused on its mechanisms of action, structure, and potential benefits in treating various conditions, including infections and inflammatory diseases. Studies have shown that DEFb104 exhibits broad-spectrum antimicrobial activity, targeting a variety of pathogens, which makes it a candidate for developing novel antimicrobial therapies, especially in the face of rising antibiotic resistance. Additionally, its ability to influence immune responses positions DEFb104 as a potential agent in enhancing vaccine efficacy or acting as an immunotherapeutic agent in cancer treatment. Continued investigation into the stability, efficacy, and delivery methods of DEFb104 is essential to fully harness its therapeutic potential and address health challenges posed by resistant microbes and immune-related disorders. Overall, the exploration of DEFb104 highlights the intersection of protein engineering and clinical therapeutics, opening avenues for innovative treatments in infectious and inflammatory diseases.
