Cat: PA1000-3413

Recombinant Human ULBP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ULBP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ULBP2;N2DL2;UL16-binding Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BZM5

  • Expression Region

    26-217aa

  • AA Sequence

    GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVS PLGKKLNVTT AWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHS SGSWQFSFDG QIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLE DFLMGMDSTL EPSAGAPLAMSSVDHHHHHH

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ULBP2 (UL16-binding protein 2) is a member of the ULBP family, which plays a significant role in the immune response, particularly in the activation of natural killer (NK) cells. ULBP2 interacts with the NKG2D receptor on NK cells and some T cells, serving as a signal for these immune effectors to recognize and eliminate stressed, infected, or transformed cells. Due to its crucial involvement in immune surveillance, ULBP2 has garnered interest in cancer research, as many tumors exploit mechanisms to downregulate ULBP2 expression, thereby evading immune detection. The study of recombinant ULBP2 proteins aims to elucidate their structure-function relationships, investigate their potential as therapeutic agents, and enhance our understanding of NK cell activation. Additionally, recombinant ULBP2 could serve as a valuable tool for developing immunotherapies or vaccines that leverage the immune system's ability to target and eliminate malignant cells. Thus, the ongoing research into ULBP2 and its recombinant forms holds promise for advancing therapeutic strategies in oncology and improving our comprehension of immune regulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US