Cat: PA1000-3401

Recombinant Human UCK2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UCK2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UCK2;UMPK;Uridine-cytidine kinase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BZX2

  • Expression Region

    1-261aa

  • AA Sequence

    MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVD YRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKE ITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQ MKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPT KKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRK RQASESSSRPHLEHHHHHH

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UCK2 (Uridine-Cytidine Kinase 2) is a notable enzyme in the nucleotide metabolism pathway, primarily responsible for the phosphorylation of uridine and cytidine. Its role in cellular processes such as RNA synthesis and cellular energy metabolism underscores its potential significance in both physiological and pathological contexts. UCK2 has been implicated in various diseases, particularly in cancers, where dysregulation of nucleotide metabolism can lead to uncontrolled cell proliferation and survival. Given its association with tumor progression, UCK2 is emerging as a promising target for therapeutic intervention. Furthermore, studying UCK2 and its biochemical properties, including its enzymatic activity and substrate specificity, is essential for understanding its functional roles within different biological systems. Advances in recombinant protein technology have made it feasible to produce UCK2 in vitro, allowing researchers to explore its structure-function relationships, potential as a biomarker, and efficacy as a drug target. The ongoing research into UCK2 not only enhances our knowledge of nucleotide metabolism but also aids in the search for novel therapeutic strategies for diseases linked to its dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US