Analytical Data
-
Gene name
UCK1
- Application
-
Alternative Names
UCK1；URK1；Uridine-cytidine kinase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HA47
-
Expression Region
143-273aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMFYSQEIRDMFHLRLFVDTDSDVRLSRRVL RDVRRGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAIN LIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLE SS
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UCK1 (uridine-cytidine kinase 1) is an enzyme that plays a crucial role in nucleotide metabolism, specifically in the phosphorylation of uridine and cytidine to their corresponding mono-phosphates, which are essential for RNA synthesis and overall cellular function. Research on UCK1 has gained prominence due to its implications in various cellular processes and its potential as a therapeutic target in diseases such as cancer and neurodegenerative disorders. Abnormal expression or mutations of UCK1 have been associated with altered RNA metabolism, leading to impaired cellular proliferation and survival. Consequently, the recombinant production of UCK1 protein enables detailed studies of its structural and functional characteristics, which can provide insights into its enzymatic mechanisms and regulatory pathways. Understanding UCK1's role in cellular signaling and metabolic pathways could pave the way for the development of novel therapeutic strategies aimed at correcting the dysregulation of nucleotide metabolism in pathological conditions. Moreover, UCK1's potential as a biomarker for certain diseases emphasizes the importance of elucidating its biological functions through recombinant protein studies, facilitating further investigations into its role in health and disease.
