Cat: PAX2000-10199

Recombinant Human PDE3B Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDE3B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    cGMP-inhibited 3'.5'-cyclic phosphodiesterase 3B. EC:3.1.4.17. CGIPDE1. CGIP1. Cyclic GMP-inhibited phosphodiesterase B. CGI-PDE B

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13370

  • Expression Region

    401-500 aa

  • AA Sequence

    LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH

  • Molecular Weight

    36.74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Phosphodiesterase 3B (PDE3B) is an important enzyme that plays a crucial role in regulating cellular levels of cyclic AMP (cAMP) and cyclic GMP (cGMP), which are vital secondary messengers involved in various physiological processes, including lipid metabolism, insulin signaling, and cardiac function. Dysregulation of PDE3B activity has been implicated in various metabolic disorders, such as obesity, type 2 diabetes, and cardiovascular diseases. Consequently, PDE3B has emerged as a promising target for therapeutic interventions aimed at these conditions. Research efforts have focused on the recombinant production of PDE3B protein to enable detailed biochemical studies, structural characterization, and high-throughput screening of potential inhibitors. The ability to produce active PDE3B in a recombinant system allows scientists to investigate its enzymatic properties, elucidate the mechanisms of its regulation, and explore its interactions with other signaling molecules. Understanding the structure-function relationship of PDE3B through crystallography and other biophysical techniques could aid in the rational design of specific inhibitors, paving the way for novel treatments for diseases associated with altered cAMP/cGMP signaling pathways. The ongoing exploration of PDE3B as a therapeutic target underscores its relevance in drug development and highlights the importance of recombinant protein research in advancing our understanding of complex biochemical pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US