Analytical Data
-
Gene name
PTPN1
- Application
-
Alternative Names
PTPN1；PTP1B；Tyrosine-Protein phosphatase non-receptor type 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18031
-
Expression Region
1-321aa
-
AA Sequence
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN
-
Molecular Weight
44.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPN1, or Protein Tyrosine Phosphatase, Non-Receptor Type 1, is a critical enzyme involved in the regulation of numerous signaling pathways by dephosphorylating tyrosine residues on target proteins. This regulatory function positions PTPN1 as a key player in various cellular processes, including cell growth, differentiation, and metabolism. Dysregulation of PTPN1 has been implicated in several diseases, particularly cancer and diabetes, making it a prime target for therapeutic intervention. Research into PTPN1 recombinant proteins aims to elucidate its structural and functional properties, providing insights into its role in cellular signaling and disease mechanisms. Understanding the exact mechanisms of PTPN1 action at the molecular level can facilitate the development of novel drugs that inhibit or enhance its activity. Furthermore, PTPN1 recombinant proteins can be utilized as tools in biochemical assays and structural biology studies, advancing our knowledge of protein interactions and post-translational modifications. As such, ongoing studies focus on the production, purification, and characterization of PTPN1 recombinants, as well as their potential applications in both basic research and clinical settings.
