Cat: PAX2000-10157

Recombinant Human PCDHA5 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PCDHA5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PCDHA5; CNRS6; Protocadherin alpha-5; PCDH-alpha-5

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y5H7

  • Expression Region

    183-289 aa

  • AA Sequence

    TNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVLDANDNAPEFDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSNLVLDDVK

  • Molecular Weight

    37.51 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PCDHA5, a member of the protocadherin alpha (PCDHA) gene cluster, has garnered significant interest due to its crucial role in the nervous system and potential implications in neurodevelopmental disorders. PCDHA5 is involved in the formation and maintenance of synapses, facilitating intercellular interactions critical for neural network development. Dysregulation of PCDHA5 expression has been linked to various neuropsychiatric conditions, making it a focal point for researchers exploring the molecular underpinnings of these disorders. The generation of recombinant PCDHA5 proteins enables detailed characterization of its biochemical properties, such as binding affinities and structural dynamics. This knowledge not only enhances our understanding of its functional mechanisms in neuronal contexts but also aids in identifying potential therapeutic targets. Moreover, recombinant PCDHA5 can serve as a valuable tool for studying its role in cell adhesion and signaling pathways within the central nervous system, thus contributing to the broader field of neurobiology. The pursuit of PCDHA5 recombinant protein research may ultimately yield insights relevant to conditions such as autism spectrum disorders and schizophrenia, highlighting its importance in both fundamental biology and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US