Analytical Data
-
Gene name
ARL6IP
- Application
-
Alternative Names
ARL6IP1; ARL6IP; ARMER; KIAA0069; ADP-ribosylation factor-like Protein 6-interacting Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15041
-
Expression Region
1-203aa
-
AA Sequence
MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
-
Molecular Weight
48.07 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARL6IP (ADP-ribosylation factor-like 6 interacting protein) is a protein implicated in several cellular processes, including vesicle trafficking, cytoskeletal organization, and cell signaling. It is known to interact with various cellular components, potentially influencing pathways related to cell proliferation, differentiation, and apoptosis. The study of ARL6IP is particularly significant in the context of cancer research, where its aberrant expression and function have been associated with tumor progression and metastasis. Researchers have been exploring the mechanisms by which ARL6IP regulates these cellular processes, aiming to elucidate its role in maintaining cellular homeostasis and its potential as a therapeutic target. Advances in recombinant protein technology have enabled the production of ARL6IP for in-depth biochemical and structural characterization. By studying the properties and interactions of ARL6IP in vitro and in vivo, scientists hope to gain insights into its functional roles and its contributions to pathological states, particularly in the context of cancer. This research not only enhances the understanding of ARL6IP's biological significance but also holds promise for the development of novel diagnostic and therapeutic strategies targeting ARL6IP-related pathways.
