Cat: PA2000-5608

Recombinant Human ARL6IP Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARL6IP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ARL6IP1; ARL6IP; ARMER; KIAA0069; ADP-ribosylation factor-like Protein 6-interacting Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15041

  • Expression Region

    1-203aa

  • AA Sequence

    MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

  • Molecular Weight

    48.07 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARL6IP (ADP-ribosylation factor-like 6 interacting protein) is a protein implicated in several cellular processes, including vesicle trafficking, cytoskeletal organization, and cell signaling. It is known to interact with various cellular components, potentially influencing pathways related to cell proliferation, differentiation, and apoptosis. The study of ARL6IP is particularly significant in the context of cancer research, where its aberrant expression and function have been associated with tumor progression and metastasis. Researchers have been exploring the mechanisms by which ARL6IP regulates these cellular processes, aiming to elucidate its role in maintaining cellular homeostasis and its potential as a therapeutic target. Advances in recombinant protein technology have enabled the production of ARL6IP for in-depth biochemical and structural characterization. By studying the properties and interactions of ARL6IP in vitro and in vivo, scientists hope to gain insights into its functional roles and its contributions to pathological states, particularly in the context of cancer. This research not only enhances the understanding of ARL6IP's biological significance but also holds promise for the development of novel diagnostic and therapeutic strategies targeting ARL6IP-related pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US