Cat: PA2000-5603

Recombinant Human ARL5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARL5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Arl5a; Arl5; ADP-ribosylation factor-like Protein 5A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y689

  • Expression Region

    1-179aa

  • AA Sequence

    MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR

  • Molecular Weight

    45.43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARL5 (ADP-ribosylation factor-like 5) is a member of the Arf family of small GTPases, which play crucial roles in various cellular processes, including membrane trafficking, cytoskeletal dynamics, and cell signaling. Recent studies have implicated ARL5 in the regulation of endocytic pathways and the maintenance of cellular homeostasis. It has been shown to interact with several key proteins involved in vesicle transport and has a significant impact on the recycling of membrane proteins, thereby influencing processes such as cell adhesion and migration. Abnormalities in ARL5 function have been associated with various diseases, including cancer and neurodegenerative disorders. Consequently, recombinant ARL5 protein has become a valuable tool for understanding its molecular mechanisms and functional roles in cell biology. By producing and analyzing ARL5 in a controlled environment, researchers aim to elucidate its structure-function relationship, investigate its interactions with other cellular proteins, and explore its potential as a therapeutic target. The purification and characterization of recombinant ARL5 can also pave the way for the development of novel strategies to manipulate its activity in disease contexts, making it a subject of considerable interest in molecular and cellular biology research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US