Analytical Data
-
Gene name
PCDH11X
- Application
-
Alternative Names
PC11X_HUMAN; PCDH-X; PCDH11; PCDH11X; PCDHX; PPP1R119; Protein phosphatase 1 regulatory subunit 119; Protocadherin 11X; Protocadherin on the X chromosome; Protocadherin-11; Protocadherin-11 X-linked; Protocadherin-S
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZA7
-
Expression Region
57-165 aa
-
AA Sequence
EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDIN
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PCDH11X (Protocadherin 11 X-linked) is a member of the protocadherin superfamily, which plays a crucial role in cell signaling and adhesion, particularly in neural tissues. Research into PCDH11X has gained traction due to its potential implications in neurological disorders, such as autism spectrum disorders and schizophrenia, as genetic studies have identified associations between PCDH11X mutations and these conditions. The gene is located on the X chromosome, making it particularly interesting for understanding sex-linked differences in neurodevelopmental traits. Recent advancements in recombinant protein technology have enabled the production of PCDH11X proteins, facilitating studies on its structural properties and functional mechanisms. Investigating PCDH11X through recombinant approaches allows researchers to explore its interactions with other cellular components, elucidate its role in synaptogenesis, and assess its potential as a therapeutic target. The development of PCDH11X recombinant proteins not only aids in advancing our knowledge of this protocadherin but also contributes to broader efforts in identifying molecular pathways involved in neurodevelopmental disorders. As the field moves forward, understanding the biology of PCDH11X could pave the way for novel diagnostic and therapeutic strategies to mitigate the impact of related diseases.
